Inhibin beta B chain(INHBB)

Cat# NB-21-25422

Size : 50ug

Brand : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P09529
Gly293–Ala407 His

Specifications Inhibin beta B chain(INHBB)

Product name Inhibin beta B chain(INHBB)
Uniprot ID P09529
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly293-Ala407
Aliases /Synonyms Activin beta-B chain
Reference PX-P4647
Note For research use only
Molecular Constructor
Gly293–Ala407 His
Product name Inhibin beta B chain(INHBB)
Uniprot ID P09529
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly293-Ala407
Aliases /Synonyms Activin beta-B chain
Reference PX-P4647
Note For research use only
Molecular Constructor
Gly293–Ala407 His

Documents

3D Representation

Inhibin beta B chain(INHBB)

Reviews

There are no reviews yet.

Be the first to review “Inhibin beta B chain(INHBB)” Cancel reply

Related products

  • PTX18616-100

    INHBB Polyclonal Antibody