ITGA2 Antibody - C-terminal region
Cat# ARP64290_P050-25UL
Size : 25ul
Brand : Aviva Systems Biology
ITGA2 Antibody - C-terminal region (ARP64290_P050)
| Datasheets/Manuals | Printable datasheet for anti-ITGA2 (ARP64290_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IF, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human ITGA2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 92%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ITGA2 (ARP64290_P050) antibody is Catalog # AAP64290 |
| Sample Type Confirmation | ITGA2 is supported by BioGPS gene expression data to be expressed in HT1080 |
| Gene Symbol | ITGA2 |
|---|---|
| Gene Full Name | Integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) |
| Alias Symbols | BR, GPIa, CD49B, HPA-5, VLA-2, VLAA2 |
| NCBI Gene Id | 3673 |
| Protein Name | Integrin alpha-2 |
| Description of Target | This gene product belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane glycoproteins composed of a distinct alpha chain and a common beta chain. They are found on a wide variety of cell types including, T cells, fibroblasts and platelets. Integrins are involved in cell adhesion and also participate in cell-surface mediated signalling. |
| Uniprot ID | P17301 |
| Protein Accession # | NP_002194 |
| Nucleotide Accession # | NM_002203 |
| Protein Size (# AA) | 1181 |
| Molecular Weight | 126kDa |
| Protein Interactions | UBC; PDIA3; ATF2; ALB; ERGIC1; SHARPIN; ITGB1; PSMD4; AUP1; ITGA2; LAMA1; CD9; HSPG2; MMP1; COL8A1; COL1A2; COL1A1; ACTA1; RABIF; CD46; |



