MARVELD3 antibody - middle region

Cat# ARP44715_P050

Size : 100ul

Brand : Aviva Systems Biology


MARVELD3 Antibody - middle region (ARP44715_P050)

Datasheets/ManualsPrintable datasheet for anti-MARVELD3 (ARP44715_P050) antibody
Product Info
Publications

α-Synuclein pre-formed fibrils impair tight junction protein expression without affecting cerebral endothelial cell function

Authors: Kuan, W. L., Bennett, N., et al.

Journal: Exp Neurol. 285, 72-81 (2016)

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Lane A: Marker. Lane B: Jurkat cell lysate. Antibody concentration: 0.25 ug/ml. Gel concentration: 12%.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MARVELD3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: SYFVLAGFSASFSSGGGFGNNYYSPFEGTELEQVRQLDQQYTILRSPLIY
Concentration0.5 mg/ml
Blocking PeptideFor anti-MARVELD3 (ARP44715_P050) antibody is Catalog # AAP44715 (Previous Catalog # AAPP12187)
ReferenceOh,J.H., (2005) Mamm. Genome 16 (12), 942-954
Gene SymbolMARVELD3
Gene Full NameMARVEL domain containing 3
Alias SymbolsMARVD3, MRVLDC3
NCBI Gene Id91862
Protein NameMARVEL domain-containing protein 3
Description of TargetThe function remains unknown.
Uniprot IDA8K820
Protein Accession #NP_001017967
Nucleotide Accession #NM_001017967
Protein Size (# AA)410
Molecular Weight46kDa
Protein InteractionsUBC;

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT
bs-1495R
 100uL