Mast Cell Protease 1, Recombinant, Rat, aa21-260, Myc-Tag
Cat# 585328-200ug
Size : 200ug
Brand : US Biological
585328 Mast Cell Protease 1, Recombinant, Rat, aa21-260, Myc-Tag


Swiss Prot
P09650Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CMajor secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion. May participate in generating perivascular beta-protein which ultimately aggregates into amyloid-beta deposits.
Source:
Recombinant protein corresponding to aa21-260 from rat Mast cell protease 1, fused to Myc-Tag at N-terminal, expressed in E.coli.
Molecular Weight:
~28.6kD
Amino Acid Sequence:
IIGGVESRPHSRPYMAHLEITTERGYKATCGGFLVTRQFVMTAAHCKGRETTVTLGVHDVSKTESTQQKIKVEKQIVHPNYNFYSNLHDIMLLKLQKKAKVTPAVDVIPLPQPSDFLKPGKMCRAAGWGQTGVTKPTSNTLREVKQRIMDKEACKNYFHYNYNFQVCVGSPRKIRSAYKGDSGGPLVCAGVAHGIVSYGRGDAKPPAVFTRISPYVPWINKVIKGKDLTSLSLHESESPS
Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

