Recombinant Human SYCP3 Protein, N-His

Cat# NB-21-33233

Size : 100µg

Brand : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8IZU3
Molecular weight:
21.00 kDa
Lys83–Phe236

Specifications Recombinant Human SYCP3 Protein, N-His

Product name ARO-P10729-100
Uniprot ID Q8IZU3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF
Molecular weight 21.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys83-Phe236
Aliases /Synonyms Synaptonemal complex protein 3, SCP3, SYCP3, SCP-3
Reference ARO-P10729
Note For research use only.
Molecular Constructor
Lys83–Phe236
Product name ARO-P10729-1MG
Uniprot ID Q8IZU3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF
Molecular weight 21.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys83-Phe236
Aliases /Synonyms Synaptonemal complex protein 3, SCP3, SYCP3, SCP-3
Reference ARO-P10729
Note For research use only.
Molecular Constructor
Lys83–Phe236
Product name ARO-P10729-50
Uniprot ID Q8IZU3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF
Molecular weight 21.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys83-Phe236
Aliases /Synonyms Synaptonemal complex protein 3, SCP3, SYCP3, SCP-3
Reference ARO-P10729
Note For research use only.
Molecular Constructor
Lys83–Phe236

Documents

3D Representation

Recombinant Human SYCP3 Protein, N-His

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human SYCP3 Protein, N-His” Cancel reply

Related products

  • ARO-A13385

    Anti-Human SYCP3 Polyclonal Antibody