RHD recombinant protein

Cat# NB-21-25576

Size : 100ug

Brand : Neo Biotech


RHD recombinant protein

Product name PX-P5200-100
Uniprot ID Q02161
Uniprot link https://www.uniprot.org/uniprot/Q02161
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALG
Molecular weight 36.51 kDa
Protein delivered with Tag? N-GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Gly87
Protein Accession Q02161
Aliases /Synonyms CD240D, RHXIII, Blood group Rh(D) polypeptide, Rh polypeptide 2, RhPII, Rhesus D antigen
Reference PX-P5200
Note For research use only
Molecular Constructor
Ser2–Gly87 N-GST