SPARC Protein, Human, Recombinant
Cat# NB-64-127429-10ug
Size : 10ug
Brand : Neo Biotech
Remove All
SPARC Protein, Human, Recombinant
(Synonyms: SPARC, Secreted protein acidic and rich in cysteine, Osteonectin (ON), ON, Basement-membrane protein 40 (BM-40)) Copy Product InfoSynonyms: SPARC, Secreted protein acidic and rich in cysteine, Osteonectin (ON), ON, Basement-membrane protein 40 (BM-40)
Catalog No. TMPH-04133 Copy Product Info
SPARC Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P09486.
For research use only—not for human use. No sales to individuals. Use as intended only.
Select Batch
Purity:> 98 % by SDS-PAGE and HPLC analyses.
Appearance:Lyophilized powder
Color:White
Contact us for more batch information
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the cell growth of Mv1Lu mink lung epithelial cells is less than 3.0 µg/mL, corresponding to a specific activity of > 333 IU/mg. |
| Description | SPARC Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is P09486. |
| Species | Human |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | P09486 |
| Amino Acid | APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI |
| Construction | 18-303 aa |
| Protein Purity | >98% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | SPARC, Secreted protein acidic and rich in cysteine, Osteonectin (ON), ON, Basement-membrane protein 40 (BM-40) |
| Molecular Weight | 32.7 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
BM-40BM40
Related Tags: SPARC Protein, Human, Recombinant chemical structure | SPARC Protein, Human, Recombinant molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

