Host species: Escherichia coli (E.coli) Origin species: Homo sapiens (Human) Uniprot ID: Q16623 Molecular weight: 31.76 kDa His Met1–Val255 Datasheet MSDS Specifications STX1A, N-His, recombinant protein Product name STX1A, N-His, recombinant protein Uniprot ID Q16623 Origin species Homo sapiens (Human) Expression system Prokaryotic expression Raw Antigen Sequence MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAV Molecular weight 31.76 kDa Protein delivered with Tag? N-terminal His Tag Purity estimated >90% as determined by SDS-PAGE Buffer PBS, pH7.5 Delivery condition Dry Ice Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Met1-Val255 Protein Accession Q16623 Reference PX-P5938 Note For research use only Molecular Constructor His Met1–Val255 Documents Datasheet MSDS 3D Representation Reviews There are no reviews yet. Be the first to review “STX1A, N-His, recombinant protein” Cancel reply
There are no reviews yet.