SUR2A antibody

Cat# orb150345-100ug

Size : 100ug

Brand : Biorbyt

Contact local distributor :


Phone : +1 850 650 7790

SUR2A antibody

SUR2A antibody

Catalog Number: orb150345

Catalog Numberorb150345
CategoryAntibodies
DescriptionMouse monoclonal to SUR2A (ATTO-488). Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6. x (6. 1 and 6. 2). The association of four K ir6. x and four SUR subunits form an ion conducting channel commonly referred to as the K ATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir 6. x potassium channel. Hence the K ATP channel monitors the energy balance within the cell..
Species/HostMouse
ClonalityMonoclonal
Clone NumberS319A-14
Tested applicationsICC, IHC, WB
ReactivityHuman, Mouse, Rat
IsotypeIgG2A
ImmunogenFusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
Concentration1 mg/ml
Dilution rangeWB (1:1000)
ConjugationATTO-488
MW120kDa
TargetSUR2A
Entrez20928
UniProt IDP70170
NCBINP_001038185.1
StorageConjugated antibodies should be stored at 4°C
Buffer/PreservativesPBS pH 7.4, 50% glycerol, 0.1% sodium azide *Storage buffer may change when conjugated
Alternative namesABCC9 antibody, Sulfonylurea receptor 2 antibody,
NoteFor research use only
Application notes1 µg/ml of SMC-431 was sufficient for detection of SUR2A in 20 µg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
Expiration Date12 months from date of receipt.