Adrenocorticotropic hormone [9002-60-2]
Referencia NB-64-79231-5mg
embalaje : 5mg
Marca : Neo Biotech
Adrenocorticotropic hormone
Catalog No. T73663 Copy Product Info
Adrenocorticotropic hormone (ACTH), a polypeptide tropic hormone secreted by the anterior pituitary gland, regulates cortisol and androgen production [1] [2].
Adrenocorticotropic hormone
Copy Product InfoAdrenocorticotropic hormone (ACTH), a polypeptide tropic hormone secreted by the anterior pituitary gland, regulates cortisol and androgen production [1] [2].
Adrenocorticotropic hormone
Cas No. 9002-60-2
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | Adrenocorticotropic hormone (ACTH), a polypeptide tropic hormone secreted by the anterior pituitary gland, regulates cortisol and androgen production [1] [2]. |
| Cas No. | 9002-60-2 |
| Sequence | Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe |
| Sequence Short | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Storage | Shipping with blue ice/Shipping at ambient temperature. |

