Anti-Human DMC1 Polyclonal Antibody

Referencia NB-21-37438

embalaje : 100µg

Marca : Neo Biotech


Clonality:
Polyclonal Antibody
Host species:
Rabbit

Specifications Anti-Human DMC1 Polyclonal Antibody

Product name ARO-A12009-100
Uniprot ID Q14565
Raw Antigen Sequence DIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Meiotic recombination protein DMC1/LIM15 homolog, LIM15, DMC1, DMC1H
Reference ARO-A12009
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human DMC1 (Asp23-Glu340).
Product name ARO-A12009-1MG
Uniprot ID Q14565
Raw Antigen Sequence DIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Meiotic recombination protein DMC1/LIM15 homolog, LIM15, DMC1, DMC1H
Reference ARO-A12009
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human DMC1 (Asp23-Glu340).
Product name ARO-A12009-50
Uniprot ID Q14565
Raw Antigen Sequence DIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Meiotic recombination protein DMC1/LIM15 homolog, LIM15, DMC1, DMC1H
Reference ARO-A12009
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human DMC1 (Asp23-Glu340).

Documents

QC & Validation

Anti-Human DMC1 Polyclonal Antibody binds to Recombinant Human DMC1 Protein, N-His in WB Assay

Anti-Human DMC1 Polyclonal Antibody binds to Recombinant Human DMC1 Protein, N-His in WB Assay

Recombinant Human DMC1 Protein, N-His(cat. No.ARO-P11849) can bind Anti-Human DMC1 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

Reviews

There are no reviews yet.

Be the first to review “Anti-Human DMC1 Polyclonal Antibody” Cancel reply

Related products

  • Recombinant Human DMC1 Protein, N-His

    ARO-P11849

    Recombinant Human DMC1 Protein, N-His