APEX1 antibody - N-terminal region

Referencia ARP37014_T100

embalaje : 100ul

Marca : Aviva Systems Biology


APEX1 Antibody - N-terminal region (ARP37014_T100)

Datasheets/ManualsPrintable datasheet for anti-APEX1 (ARP37014_T100) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of mouse APEX1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Goat: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: ETKKSKGAAKKTEKEAAGEGPVLYEDPPDQKTSPSGKSATLKICSWNVDG
Concentration1.0 mg/ml
Blocking PeptideFor anti-APEX1 (ARP37014_T100) antibody is Catalog # AAP37014 (Previous Catalog # AAPP09925)
ReferenceIzumi,T., et al., (2005) Proc. Natl. Acad. Sci. U.S.A. 102 (16), 5739-5743
Gene SymbolAPEX1
Gene Full NameApurinic/apyrimidinic endonuclease 1
Alias SymbolsHA, APE, Apex, HAP1, Ref-, Ref-1
NCBI Gene Id11792
Protein NameApurinic/apyrimidinic endonuclease 1 EMBL EDL20835.1
Description of TargetApurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells.
Uniprot IDQ544Z7
Protein Accession #NP_033817
Nucleotide Accession #NM_009687
Protein Size (# AA)317
Molecular Weight35kDa
Protein InteractionsPcna; Gadd45a; Eed; Mutyh; Plcb1; Hdac1; Sin3a; Hdac2;