CD292 / BMPR1A, N-His, recombinant protein

Referencia NB-21-25748

embalaje : 100ug

Marca : Neo Biotech


Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P36894
Molecular weight:
16.50 kDa
His Gln24–Arg152

Specifications CD292 / BMPR1A, N-His, recombinant protein

Product name CD292 / BMPR1A, N-His, recombinant protein
Uniprot ID P36894
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSI
Molecular weight 16.50 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln24-Arg152
Protein Accession P36894
Reference PX-P5610
Note For research use only
Molecular Constructor
His Gln24–Arg152

Documents

3D Representation

CD292 / BMPR1A, N-His, recombinant protein

Reviews

There are no reviews yet.

Be the first to review “CD292 / BMPR1A, N-His, recombinant protein” Cancel reply

Related products

  • PTX17851

    Anti His tag mouse monoclonal antibody