Fibroblast growth factor 21(FGF21)(29-210)

Referencia NB-21-24583

embalaje : 50ug

Marca : Neo Biotech


Fibroblast growth factor 21(FGF21)(29-210)

Product name Fibroblast Growth Factor proteins 21(FGF21)(29-210)
Uniprot ID Q9JJN1
Uniprot link https://www.uniprot.org/uniprot/Q9JJN1
Expression system Prokaryotic expression
Raw Antigen Sequence AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
Molecular weight 21.15kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80%by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Ala29-Ser210
Protein Accession Q9JJN1
Spec:Entrez GeneID 56636
Spec:NCBI Gene Aliases Fgf8c
NCBI Reference Q9JJN1
Aliases /Synonyms FGF-21
Reference PX-P4735
Note For research use only
Molecular Constructor
His Ala29–Ser210