Glucagon (1-29), FAM-labeled
Referencia HY-P0082F-10mg
embalaje : 10mg
Marca : MedChemExpress
| Descripciòn |
Glucagon (1-29), FAM-labeled is a biological active peptide. (FAM labeled HY-P0082) |
||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Peso molecular |
3841.04 |
||||||||||||
| Fòrmula |
C153H225N43O49S |
||||||||||||
| Appearance |
Solid |
||||||||||||
| Color |
Light yellow to yellow |
||||||||||||
| Sequence |
{FAM}-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH |
||||||||||||
| Sequence Shortening |
{FAM}-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT |
||||||||||||
| Envío | Room temperature in continental US; may vary elsewhere. |
||||||||||||
| Almacenamiento |
Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
||||||||||||
| Solvente y solubilidad |
In Vitro:
DMSO : ≥ 100 mg/mL (26.03 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO) *"≥" means soluble, but saturation unknown. Preparing
Stock Solutions
View the Complete Stock Solution Preparation Table
*
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol) Concentration (start) × Volume (start) = Concentration (final) × Volume (final) This equation is commonly abbreviated as: C1V1 = C2V2 In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:
Dosage mg/kgAnimal weight Dosing volume Number of animals Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration:
mg/mL
|
||||||||||||
| Pureza y Documentación |

