Reactivos e instrumentos para inmunología, biología celular y biología molecular.
 
> Human BDNF

Human BDNF

Imprimir Imprimir
Por favor conéctese

Referencia NB-21-25515

embalaje : 100ug

Marca : Neo Biotech


Human BDNF

Product name Human BDNF
Uniprot ID P23560
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence RHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Molecular weight 15.16kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Arg128-Arg247
Aliases /Synonyms Brain-derived neurotrophic factor,BDNF,Abrineurin,BDNF precursor form,ProBDNF
Reference PX-P4907
Note For research use only
Molecular Constructor
His Arg128–Arg247