Human IL6 Recombinant Protein

Referencia NB-21-23089

embalaje : 100ug

Marca : Neo Biotech


Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P05231
Molecular weight:
49.8 kDa
Full-length

Specifications Human IL6 Recombinant Protein

Product name Human IL6 Recombinant Protein
Uniprot ID P05231
Uniprot link http://www.uniprot.org/uniprot/P05231
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular weight 49.8 kDa
Purity estimated 95%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference P05231
Aliases /Synonyms Interleukin 6, IL-6, MGI2-A, MGI2A, HGF, BSF2, HSF, IFNB2, B-Cell Stimulatory Factor-2, B-cell stimulatory factor 2, Hybridoma/Plasmacytoma Growth Factor proteins, Hepatocyte Stimulating Factor, Cytotoxic T-Cell Differentiation Factor,CTL differentiation factor, CDF, Hybridoma Growth Factor proteins,Interferon beta-2,IFN-beta-2,BSF-2
Reference PX-P3013
Note For research use only
Molecular Constructor
Full-length
Product name Human IL6 Recombinant Protein
Uniprot ID P05231
Uniprot link http://www.uniprot.org/uniprot/P05231
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular weight 49.8 kDa
Purity estimated 95%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference P05231
Aliases /Synonyms Interleukin 6, IL-6, MGI2-A, MGI2A, HGF, BSF2, HSF, IFNB2, B-Cell Stimulatory Factor-2, B-cell stimulatory factor 2, Hybridoma/Plasmacytoma Growth Factor, Hepatocyte Stimulating Factor, Cytotoxic T-Cell Differentiation Factor,CTL differentiation factor, CDF, Hybridoma growth factor,Interferon beta-2,IFN-beta-2,BSF-2
Reference PX-P3013
Note For research use only
Molecular Constructor
Full-length
Product name Human IL6 Recombinant Protein
Uniprot ID P05231
Uniprot link http://www.uniprot.org/uniprot/P05231
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular weight 49.8 kDa
Purity estimated 95%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference P05231
Aliases /Synonyms Interleukin 6, IL-6, MGI2-A, MGI2A, HGF, BSF2, HSF, IFNB2, B-Cell Stimulatory Factor-2, B-cell stimulatory factor 2, Hybridoma/Plasmacytoma Growth Factor proteins, Hepatocyte Stimulating Factor, Cytotoxic T-Cell Differentiation Factor,CTL differentiation factor, CDF, Hybridoma Growth Factor proteins,Interferon beta-2,IFN-beta-2,BSF-2
Reference PX-P3013
Note For research use only
Molecular Constructor
Full-length
Product name PX-P3013-1MG
Uniprot ID P05231
Uniprot link http://www.uniprot.org/uniprot/P05231
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular weight 49.8 kDa
Purity estimated 95%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference P05231
Aliases /Synonyms Interleukin 6, IL-6, MGI2-A, MGI2A, HGF, BSF2, HSF, IFNB2, B-Cell Stimulatory Factor-2, B-cell stimulatory factor 2, Hybridoma/Plasmacytoma Growth Factor proteins, Hepatocyte Stimulating Factor, Cytotoxic T-Cell Differentiation Factor,CTL differentiation factor, CDF, Hybridoma Growth Factor proteins,Interferon beta-2,IFN-beta-2,BSF-2
Reference PX-P3013
Note For research use only.
Molecular Constructor
Full-length

Documents

QC & Validation

Human IL6 Recombinant Protein binds to Siltuximab Biosimilar – Anti-IL6 mAb in indirect ELISA assay

Human IL6 Recombinant Protein binds to Siltuximab Biosimilar – Anti-IL6 mAb in indirect ELISA assay

Immobilized Human IL6 Recombinant Protein (cat. No.PX-P3013) at 0.5µg/mL (100µL/well) can bind Siltuximab Biosimilar Anti-IL6 mAb (cat. No.PX-TA1029) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 62.18M.

3D Representation

Human IL6 Recombinant Protein

Publications

  • Breton J, La Fiura A, Bertolero F, Orsini G, Valsasina B, Ziliotto R, De Filippis V, Polverino de Laureto P, Fontana A. Structure, stability and biological properties of a N-terminally truncated form of recombinant human interleukin-6 containing a single disulfide bond. Eur J Biochem. 1995 Jan 15;227(1-2):573-81. PubMed PMID: 7851440.

Reviews

There are no reviews yet.

Be the first to review “Human IL6 Recombinant Protein” Cancel reply

Related products

  • SDS-PAGE for Siltuximab Biosimilar - Anti-IL6 mAb

    PX-TA1029

    Siltuximab Biosimilar – Anti-IL6 mAb – Research Grade