Human Interleukin 6 receptor (IL6R) Recombinant Protein
Referencia orb1650433-1mg
embalaje : 1mg
Marca : Biorbyt
Human Interleukin 6 receptor (IL6R) Recombinant Protein
SKU: orb1650433
Description
Research Area
Immunology & Inflammation
Images & Validation
−
Key Properties
−| Species/Host | Yeast |
|---|---|
| Immunogen | Expression Region:20-365aa; Sequence Info:Partial |
| Tag | N-terminal 6xHis-tagged |
| MW | 40.5 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
|---|---|
| Buffer/Preservatives | Tris-based buffer50% glycerol |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Interleukin 6 receptor, isoform CRA_a
−
CD126/IL6R/IL-6RA Human Recombinant Antibody [orb2975300]
FC
Human
Human
Monoclonal
Unconjugated
50 μg, 100 μgRecombinant human IL-6R-Beta protein, C-hFc-His (HEK293) [orb1516616]
>90% as determined by SDS-PAGE
95.2 kDa
100 μg, 500 μg, 20 μgRecombinant human IL-6R Alpha protein, His (HEK293) [orb1516659]
>95% as determined by SDS-PAGE
70 kDa
100 μg, 500 μg, 20 μg
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide