Reactivos e instrumentos para inmunología, biología celular y biología molecular.
 
> Interferon alpha

Interferon alpha

Imprimir Imprimir
Por favor conéctese

Referencia NB-21-24864

embalaje : 50ug

Marca : Neo Biotech


Interferon alpha

Product name Interferon alpha
Uniprot ID A0PA06
Uniprot link https://www.uniprot.org/uniprot/A0PA06
Expression system Prokaryotic expression
Raw Antigen Sequence CDLPLTHSLVDRRALILLGQMRRISPFSCLKDREDFGFPQGVLHGNQFQEAQAIAVAHEVTRQTFLLFCTEASSAAWDETLRSRFCTGLYQQLIHLEACQTREVGAEETPLLDEDSTLAVRSYFQRLFLYLQEKKHSPCAWEIIRAEIMRSYSLSTHLKETKE
Molecular weight 20.85KDa
Purity estimated 90%
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Cys24-Glu186
Aliases /Synonyms Interferon alpha
Reference PX-P4357
Note For research use only
Molecular Constructor
Cys24–Glu186