embalaje : 50ug
| Product name | Interferon alpha |
|---|---|
| Uniprot ID | A0PA06 |
| Uniprot link | https://www.uniprot.org/uniprot/A0PA06 |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | CDLPLTHSLVDRRALILLGQMRRISPFSCLKDREDFGFPQGVLHGNQFQEAQAIAVAHEVTRQTFLLFCTEASSAAWDETLRSRFCTGLYQQLIHLEACQTREVGAEETPLLDEDSTLAVRSYFQRLFLYLQEKKHSPCAWEIIRAEIMRSYSLSTHLKETKE |
| Molecular weight | 20.85KDa |
| Purity estimated | 90% |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Cys24-Glu186 |
| Aliases /Synonyms | Interferon alpha |
| Reference | PX-P4357 |
| Note | For research use only |
| Molecular Constructor | Cys24–Glu186 |