mouse Anti-KLF4 (Kruppel-like Factor 4 (gut), EZF, GKLF) (HRP) Monoclonal Antibody [Clone:X1]
Referencia 247963-HRP-100ul
embalaje : 100ul
Marca : US Biological
247963-HRP KLF4 (Kruppel-like Factor 4 (gut), EZF, GKLF) (HRP)
Clone Type
MonoclonalHost
mouseIsotype
IgG1,kGrade
PurifiedApplications
E IF WBAccession #
AAH29923Shipping Temp
Blue IceStorage Temp
-20°CMouse monoclonal antibody raised against a partial recombinant KLF4.
Applications:
Suitable for use in Immunofluorescence, Western Blot. Other applications not tested.
Recommended Dilution:
Optimal dilutions to be determined by the researcher.
AA Sequence:
VLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRD
Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.

