TRIB3 (Tribbles Homolog 3, TRB3, TRB-3, Neuronal Cell Death-inducible Putative Kinase, NIPK, p65-interacting Inhibitor of NF-kappa-B, C20orf97, SINK, SKIP3) (FITC)
Referencia 134719-FITC-100ul
embalaje : 100ul
Marca : US Biological
134719-FITC TRIB3 (Tribbles Homolog 3, TRB3, TRB-3, Neuronal Cell Death-inducible Putative Kinase, NIPK, p65-interacting Inhibitor of NF-kappa-B, C20orf97, SINK, SKIP3) (FITC)
Clone Type
MonoclonalHost
mouseSource
humanIsotype
IgG1,kGrade
Affinity PurifiedApplications
FLISA IF WBCrossreactivity
HuAccession #
BC027484, AAH27484Shipping Temp
Blue IceStorage Temp
-20°C
Applications:
Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested.
Recommended Dilution:
Immunofluorescence: 10ug/ml
Optimal dilutions to be determined by the researcher.
AA Sequence:
PDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDMH
Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.

