Prolactin Protein, Pig, Recombinant (His & SUMO)
Referencia NB-64-51791-100ug
embalaje : 100ug
Marca : Neo Biotech
Remove All
Prolactin Protein, Pig, Recombinant (His & SUMO)
(Synonyms: Prolactin, PRL) Copy Product InfoSynonyms: Prolactin, PRL
Catalog No. TMPH-03122 Copy Product Info
Prolactin acts primarily on the mammary gland by promoting lactation. Prolactin Protein, Pig, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 39.0 kDa and the accession number is P01238.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Prolactin acts primarily on the mammary gland by promoting lactation. Prolactin Protein, Pig, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 39.0 kDa and the accession number is P01238. |
| Species | Sus scrofa (Pig) |
| Expression System | E. coli |
| Tag | N-6xHis-SUMO |
| Accession Number | P01238 |
| Amino Acid | LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC |
| Construction | 31-229 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Prolactin, PRL |
| Research Background | Prolactin acts primarily on the mammary gland by promoting lactation. |
| Molecular Weight | 39.0 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Related Tags: Prolactin Protein, Pig, Recombinant (His & SUMO) chemical structure | Prolactin Protein, Pig, Recombinant (His & SUMO) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

