ARO-A13857
Recombinant Human POU5F1/OCT3/OCT4, N-His
Referencia NB-21-29555
embalaje : 100µg
embalaje : 100µg
| Product name | ARO-P13523-100 |
|---|---|
| Uniprot ID | Q01860 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | SQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSS |
| Molecular weight | 20.18 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ser136-Ser289 |
| Aliases /Synonyms | Octamer-binding protein 4, Oct-4, OCT3, OCT4, OTF3, OTF-3, Octamer-binding transcription factor 3, POU5F1, Oct-3, POU domain, class 5, transcription factor 1, Octamer-binding protein 3 |
| Reference | ARO-P13523 |
| Note | For research use only. |
| Molecular Constructor | Ser136–Ser289 |
| Product name | ARO-P13523-1MG |
|---|---|
| Uniprot ID | Q01860 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | SQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSS |
| Molecular weight | 20.18 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ser136-Ser289 |
| Aliases /Synonyms | Octamer-binding protein 4, Oct-4, OCT3, OCT4, OTF3, OTF-3, Octamer-binding transcription factor 3, POU5F1, Oct-3, POU domain, class 5, transcription factor 1, Octamer-binding protein 3 |
| Reference | ARO-P13523 |
| Note | For research use only. |
| Molecular Constructor | Ser136–Ser289 |
| Product name | ARO-P13523-50 |
|---|---|
| Uniprot ID | Q01860 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | SQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSS |
| Molecular weight | 20.18 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ser136-Ser289 |
| Aliases /Synonyms | Octamer-binding protein 4, Oct-4, OCT3, OCT4, OTF3, OTF-3, Octamer-binding transcription factor 3, POU5F1, Oct-3, POU domain, class 5, transcription factor 1, Octamer-binding protein 3 |
| Reference | ARO-P13523 |
| Note | For research use only. |
| Molecular Constructor | Ser136–Ser289 |
There are no reviews yet.