Recombinant Human POU5F1/OCT3/OCT4, N-His

Referencia NB-21-29555

embalaje : 100µg

Marca : Neo Biotech


Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q01860
Molecular weight:
20.18 kDa
Ser136–Ser289

Specifications Recombinant Human POU5F1/OCT3/OCT4, N-His

Product name ARO-P13523-100
Uniprot ID Q01860
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSS
Molecular weight 20.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser136-Ser289
Aliases /Synonyms Octamer-binding protein 4, Oct-4, OCT3, OCT4, OTF3, OTF-3, Octamer-binding transcription factor 3, POU5F1, Oct-3, POU domain, class 5, transcription factor 1, Octamer-binding protein 3
Reference ARO-P13523
Note For research use only.
Molecular Constructor
Ser136–Ser289
Product name ARO-P13523-1MG
Uniprot ID Q01860
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSS
Molecular weight 20.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser136-Ser289
Aliases /Synonyms Octamer-binding protein 4, Oct-4, OCT3, OCT4, OTF3, OTF-3, Octamer-binding transcription factor 3, POU5F1, Oct-3, POU domain, class 5, transcription factor 1, Octamer-binding protein 3
Reference ARO-P13523
Note For research use only.
Molecular Constructor
Ser136–Ser289
Product name ARO-P13523-50
Uniprot ID Q01860
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSS
Molecular weight 20.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser136-Ser289
Aliases /Synonyms Octamer-binding protein 4, Oct-4, OCT3, OCT4, OTF3, OTF-3, Octamer-binding transcription factor 3, POU5F1, Oct-3, POU domain, class 5, transcription factor 1, Octamer-binding protein 3
Reference ARO-P13523
Note For research use only.
Molecular Constructor
Ser136–Ser289

Documents

3D Representation

Recombinant Human POU5F1/OCT3/OCT4, N-His

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human POU5F1/OCT3/OCT4, N-His” Cancel reply

Related products

  • Anti-POU5F1/OCT3/OCT4 Polyclonal antibody

    ARO-A13857

    Anti-POU5F1/OCT3/OCT4 Polyclonal antibody