Recombinant Neisseria meningitidis serogroup B Penicillin-binding protein 1A(mrcA),partial
Referencia orb1647323-1mg
embalaje : 1mg
Marca : Biorbyt
Recombinant Neisseria meningitidis serogroup B Penicillin-binding protein 1A(mrcA),partial
SKU: orb1647323
Description
Key Properties
−| Expression System | E.coli |
|---|---|
| Immunogen | Expression Region: 206-413aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| MW | 40 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Protein Sequence | KAPSAYNPIVNPERAKLRQKYILNNMLEEKMITVQQRDQALNEELHYERFVRKIDQSALYVAEMVRQELYEKYGEDAYTQGFKVYTTVRADHQKVATEALRKALRNFDRGSSYRGAENYIDLSKSEDVEETVSQYLSGLYTVDKMVPAVVLDVTKKKNVVIQLPGGRRVTLDRRALGFAARAVNNEKMGEDRIRRGAVIRVKNNGGRW |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Tris-based buffer50% glycerol |
| Expiration Date | 6 months from date of receipt. |


