embalaje : 100ug
| Product name | PX-P4091-100 |
|---|---|
| Uniprot ID | P60033 |
| Uniprot link | http://www.uniprot.org/uniprot/P60033 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK |
| Molecular weight | 10.59kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Phe113~Lys201 |
| Aliases /Synonyms | TAPA1, TSPAN28 |
| Reference | PX-P4091 |
| Note | For research use only |
| Molecular Constructor | His Phe113~Lys201 |