cDNA FLJ59602, highly similar to Lactotransferrin
Referencia NB-21-24441
embalaje : 50ug
embalaje : 50ug
| Product name | cDNA FLJ59602, highly similar to Lactotransferrin |
|---|---|
| Uniprot ID | B4E1L2 |
| Uniprot link | https://www.uniprot.org/uniprot/B4E1L2 |
| Expression system | Eukaryotic expression |
| Raw Antigen Sequence | MHSSALLCCLVLLTGVRAGRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIGGGGSGGGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK |
| Molecular weight | 33.87kDa |
| Purity estimated | >90% by SDS-PAGE |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Host species | Mammalian cells |
| Fragment Type | Gly20-IIe66 |
| Aliases /Synonyms | / |
| Reference | PX-P4870 |
| Note | For research use only |
| Molecular Constructor | Gly20–IIe66 |