- Host species:
- Mammalian cells
- Origin species:
- Homo sapiens (Human)
- Uniprot ID:
- P12644
- Molecular weight:
- 40.96 kDa
Fc Arg292–Arg408
embalaje : 100ug
| Product name | Human BMP4 recombinant protein |
|---|---|
| Uniprot ID | P12644 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Raw Antigen Sequence | RSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
| Molecular weight | 40.96 kDa |
| Protein delivered with Tag? | N-Terminal Fc Tag |
| Purity estimated | >85% by SDS-PAGE |
| Buffer | 0.01M PBS, pH 7.4. |
| Delivery condition | Dry Ice |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Arg292-Arg408 |
| Aliases /Synonyms | BMP2B, BMP-2B, DVR4, Bone morphogenetic protein 4, BMP-4, BMP4, Bone morphogenetic protein 2B |
| Reference | PX-P6146 |
| Note | For research use only |
| Molecular Constructor | Fc Arg292–Arg408 |
Human BMP4 (Bone Morphogenetic Protein 4) is a member of the TGF-β (Transforming Growth Factor-beta) superfamily of proteins. It is a homodimeric protein, meaning it is composed of two identical subunits, each containing 408 amino acids. The molecular weight of the protein is approximately 44 kDa. The primary structure of Human BMP4 consists of a signal peptide, propeptide, and mature protein region. The mature protein region is further divided into seven conserved cysteine residues, which are important for protein folding and stability. The structure of Human BMP4 is highly conserved across different species, with 97% amino acid sequence identity between human and mouse BMP4.
Human BMP4 plays a crucial role in various cellular processes, including embryonic development, tissue homeostasis, and bone formation. It acts as a potent morphogen, influencing cell fate determination and differentiation during embryogenesis. In adults, BMP4 is involved in tissue repair and regeneration, particularly in bone, cartilage, and muscle tissues. It also has anti-inflammatory properties and plays a role in immune regulation. The activity of Human BMP4 is mediated through binding to specific cell surface receptors, including BMP type I and type II receptors, leading to the activation of downstream signaling pathways.
Due to its crucial role in various cellular processes, Human BMP4 has emerged as a promising therapeutic target for a wide range of diseases and conditions. One of the most well-known therapeutic applications of Human BMP4 is in bone regeneration and repair. It has been successfully used in clinical settings to promote bone healing in patients with fractures, non-union, and spinal fusion surgeries. Human BMP4 has also shown potential in treating bone-related disorders such as osteoporosis and osteoarthritis.
In addition to its role in bone formation, Human BMP4 has also been explored as a therapeutic target for other conditions. In cancer research, it has been found to have both tumor suppressive and promoting effects, depending on the type of cancer. Studies have shown that Human BMP4 can inhibit the growth of certain types of cancer cells, including breast, lung, and colon cancer. On the other hand, it has been implicated in promoting the growth and metastasis of prostate and pancreatic cancer. Further research is needed to fully understand the role of Human BMP4 in cancer and its potential as a therapeutic target.
Apart from its therapeutic applications, Human BMP4 recombinant protein is widely used in research settings. It is used as a tool to study the role of BMP4 in various cellular processes and to investigate potential therapeutic interventions. The recombinant protein is also used in cell culture experiments to induce differentiation of stem cells into bone and cartilage cells. In addition, Human BMP4 is used in animal models to study its effects on tissue repair and regeneration.
In conclusion, Human BMP4 recombinant protein is a highly conserved, homodimeric protein with a crucial role in various cellular processes. It acts as a potent morphogen and is involved in tissue repair, immune regulation, and bone formation. Due to its therapeutic potential, it has emerged as a promising target for the treatment of bone-related disorders and certain types of cancer. In research settings, it is widely used to study the role of BMP4 and its potential as a therapeutic intervention. Further research on Human BMP4 is essential to fully understand its complex functions and to develop effective treatments for diseases and conditions related to its activity.
PTX17868
There are no reviews yet.