Reactivos e instrumentos para inmunología, biología celular y biología molecular.
 
> Human CD9 recombinant protein

Human CD9 recombinant protein

Imprimir Imprimir
Por favor conéctese

Referencia NB-21-27665

embalaje : 100µg

Marca : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P21926
Molecular weight:
12.58 kDa
Ser112–Ile195 His
Human CD9 recombinant protein

Specifications Human CD9 recombinant protein

Product name PX-P6424-100
Uniprot ID P21926
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Molecular weight 12.58 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser112-Ile195
Aliases /Synonyms 5H9 antigen, Cell growth-inhibiting gene 2 protein, Leukocyte antigen MIC3, Motility-related protein, MRP-1, Tetraspanin-29, Tspan-29, p24, CD9, CD9, MIC3, TSPAN29, GIG2CD9 antigen,
Reference PX-P6424
Molecular Constructor
Ser112–Ile195 His
Product name PX-P6424-1MG
Uniprot ID P21926
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Molecular weight 12.58 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser112-Ile195
Aliases /Synonyms 5H9 antigen, Cell growth-inhibiting gene 2 protein, Leukocyte antigen MIC3, Motility-related protein, MRP-1, Tetraspanin-29, Tspan-29, p24, CD9, CD9, MIC3, TSPAN29, GIG2CD9 antigen,
Reference PX-P6424
Molecular Constructor
Ser112–Ile195 His
Product name PX-P6424-50
Uniprot ID P21926
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Molecular weight 12.58 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser112-Ile195
Aliases /Synonyms 5H9 antigen, Cell growth-inhibiting gene 2 protein, Leukocyte antigen MIC3, Motility-related protein, MRP-1, Tetraspanin-29, Tspan-29, p24, CD9, CD9, MIC3, TSPAN29, GIG2CD9 antigen,
Reference PX-P6424
Molecular Constructor
Ser112–Ile195 His

3D Representation

Human CD9 recombinant protein

Reviews

There are no reviews yet.

Be the first to review “Human CD9 recombinant protein” Cancel reply

Related products

  • SDS-PAGE for Monalizumab Biosimilar - Anti-KLRC1, NKG2A, CD159a, CD94 mAb - Research Grade

    PX-TA1392

    Monalizumab Biosimilar – Anti-KLRC1, NKG2A, CD159a, CD94 mAb – Research Grade