IL8 / CXCL8, N-His, recombinant protein

Referencia NB-21-25933

embalaje : 100ug

Marca : Neo Biotech


IL8 / CXCL8, N-His, recombinant protein

Product name IL8 / CXCL8, N-His, recombinant protein
Uniprot ID P10145
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Molecular weight 11.23 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Ala23-Ser99
Protein Accession P10145
Reference PX-P5797
Note For research use only
Molecular Constructor
His Ala23–Ser99