Mouse Excitatory amino acid transporter 2 (Slc1a2) Recombinant Protein
Referencia orb1631534-100ug
embalaje : 100ug
Marca : Biorbyt
Mouse Excitatory amino acid transporter 2 (Slc1a2) Recombinant Protein
SKU: orb1631534
Description
Images & Validation
−
Key Properties
−| Species/Host | E. coli |
|---|---|
| Immunogen | Expression Region:143-238aa; Sequence Info:Extracellular Domain |
| Tag | N-terminal GST-tagged |
| MW | 37.6 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDG |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
|---|---|
| Buffer/Preservatives | Tris-based buffer50% glycerol |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−GLT-1Sodium-dependent glutamate,aspartate transporter 2Solute carrier family 1 member 2
−
Recombinant mouse EAAT2 protein, GST & His [orb1516261]
>95% as determined by SDS-PAGE
42 kDa
100 μg, 500 μg, 20 μgMouse SLC1A2 Recombinant Protein (N-His) [orb3154858]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
11.51 kDa
50 μg, 100 μg, 1 mgMouse Excitatory amino acid transporter 2 (Slc1a2) Recombinant Protein [orb1651150]
Greater than 90% as determined by SDS-PAGE.
37.6 kDa
100 μg, 20 μg, 1 mg
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide