Clinisciences > SLC22A13 antibody - N-terminal region
SLC22A13 antibody - N-terminal region
Referencia ARP43878_P050
embalaje : 100ul
Marca : Aviva Systems Biology
SLC22A13 Antibody - N-terminal region (ARP43878_P050)
| Datasheets/Manuals | Printable datasheet for anti-SLC22A13 (ARP43878_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Dog, Horse, Pig |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC22A13 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Dog: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 79%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: FFAHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLM |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SLC22A13 (ARP43878_P050) antibody is Catalog # AAP43878 (Previous Catalog # AAPP25415) |
| Reference | Daigo,Y., (1999) Cancer Res. 59 (8), 1966-1972 |
|---|---|
| Gene Symbol | SLC22A13 |
| Gene Full Name | Solute carrier family 22 (organic anion transporter), member 13 |
| Alias Symbols | OAT10, OCTL1, OCTL3, ORCTL3, ORCTL-3 |
| NCBI Gene Id | 9390 |
| Protein Name | Solute carrier family 22 member 13 |
| Description of Target | SLC22A13 is a member of the organic-cation transporter family. SLC22A13 is a transmembrane protein involved in the transport of small molecules. This protein can function to mediate urate uptake and is a high affinity nicotinate exchanger in the kidneys and the intestine.This gene encodes a member of the organic-cation transporter family. It is located in a gene cluster with another member of the family, organic cation transporter like 4. The encoded protein is a transmembrane protein which is thought to transport small molecules and since this protein is conserved among several species, it is suggested to have a fundamental role in mammalian systems. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-28 DA629093.1 1-28 29-485 AB010438.1 1-457 486-1375 BC035973.1 486-1375 1376-1554 AB010438.1 1348-1526 1555-2555 BC035973.1 1533-2533 |
| Uniprot ID | Q9Y226 |
| Protein Accession # | NP_004247 |
| Nucleotide Accession # | NM_004256 |
| Protein Size (# AA) | 551 |
| Molecular Weight | 61kDa |
Biological process
| Name | # of Products |
|---|---|
| Organic cation transport | 12 |
Cellular components
| Name | # of Products |
|---|---|
| Integral to plasma membrane | 817 |
| Membrane | 2769 |
Protein function
| Name | # of Products |
|---|---|
| Organic cation transmembrane transporter activity | 11 |
| Transmembrane transporter activity | 66 |


