Synthetic SNAP Protein

Referencia NB-21-25206

embalaje : 50ug

Marca : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Origin species:
synthetic construction
Uniprot ID:
P08515
Molecular weight:
45.44kDa
Unknown Yes

Specifications Synthetic SNAP Protein

Product name Synthetic SNAP Protein
Uniprot ID P08515
Uniprot link http://www.uniprot.org/uniprot/P08515
Origin species synthetic construction
Expression system Prokaryotic expression
Raw Antigen Sequence MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFP VPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPAATAAVKTALSGNPVPILIPCHRVVSSSGAVGGYEG GLAVKEWLLAHEGHRLGKPGLGAGIDAIMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEF PNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKM FEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGG GDHPPKSD
Molecular weight 45.44kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
Protein Accession AFU51890.1
Spec:SwissProtID P08515
NCBI Reference AFU51890.1
Aliases /Synonyms SNAP, Glutathione S-transferase class-mu 26 kDa isozyme ou GST 26 ou Sj26 antigen ou SjGST ou Glutathione S-transferase domain-containing protein
Reference PX-P2096
Note For research use only
Molecular Constructor
Unknown Yes
Product name Synthetic SNAP Protein
Uniprot ID P08515
Uniprot link http://www.uniprot.org/uniprot/P08515
Origin species synthetic construction
Expression system Prokaryotic expression
Raw Antigen Sequence MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFP VPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPAATAAVKTALSGNPVPILIPCHRVVSSSGAVGGYEG GLAVKEWLLAHEGHRLGKPGLGAGIDAIMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEF PNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKM FEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGG GDHPPKSD
Molecular weight 45.44kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
Protein Accession AFU51890.1
Spec:SwissProtID P08515
NCBI Reference AFU51890.1
Aliases /Synonyms SNAP, Glutathione S-transferase class-mu 26 kDa isozyme ou GST 26 ou Sj26 antigen ou SjGST ou Glutathione S-transferase domain-containing protein
Reference PX-P2096
Note For research use only
Molecular Constructor
Unknown Yes

Description

Generalities on SNAP Protein

Synaptosome nerve-associated protein also known as SNAP protein is component of SNARE protein complex. SNAP protein is involved in the exocytotic release of neurotransmitters during synaptic transmission. It is believed that SNAP protein controls exocytic and endocytic processes at the presynaptic terminal. Data suggests that SNAP protein is also implicated in postsynaptic receptor trafficking. However, a clear demonstration of SNAP protein localization in postsynaptic neuron is lacking. Even more so, since data suggests that this protein is located in the presynaptic location exclusively.

SNAP protein has also been suggested to play an important role in modulation of voltage-gated calcium channel-mediated (VGCC) signaling, short term plasticity, long term plasticity, dendritic spine morphogenesis, cognitive ability, learning and memory and network excitability. As such, deregulation of SNAP protein has been linked to several disorders such as early onset bipolar disorder, ADHD, increased risk of major depressive disorder and schizophrenia.

SNAP along with syntaxin and synaptobrevin (which are vesicle-associated membranes) have been implicated as central elements of an exocytotic membrane fusion complex in neurons. It is believed that SNAP protein binds directly to both synaptobrevin and syntaxin. Data suggests that SNAP is implicated in the final steps of intracellular membrane fusion.

Documents

Reviews

There are no reviews yet.

Be the first to review “Synthetic SNAP Protein” Cancel reply

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call