SYP Rabbit Polyclonal Antibody (HRP)

Referencia orb2118083-100ul

embalaje : 100ul

Marca : Biorbyt


SYP Rabbit Polyclonal Antibody (HRP)

SKU: orb2118083

Description

SYP Rabbit Polyclonal Antibody (HRP) is an HRP conjugated, affinity purified antibody which is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human SYP. This antibody is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Zebrafish. It is supplied as a liquid in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SYP
Protein SequenceSynthetic peptide located within the following region: MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGE
Molecular Weight34kDa
PurificationAffinity Purified
ConjugationHRP

Storage & Handling

StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

MRX96, MRXSYP

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003170

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol