Reactivos e instrumentos para inmunología, biología celular y biología molecular.
 
> Vascular endothelial growth factor A(VEGFA)

Vascular endothelial growth factor A(VEGFA)

Imprimir Imprimir
Por favor conéctese

Referencia NB-21-25350

embalaje : 50ug

Marca : Neo Biotech


Vascular endothelial growth factor A(VEGFA)

Product name Vascular endothelial Growth Factor proteins A(VEGFA)
Uniprot ID P15692-4
Uniprot link https://www.uniprot.org/uniprot/P15692#P15692-4
Expression system Eukaryotic expression
Raw Antigen Sequence MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight 20.13kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Mammalian cells
Fragment Type Met1-Arg191
Protein Accession P15692
Spec:Entrez GeneID 7422
Spec:NCBI Gene Aliases VPF; VEGF; MVCD1
Spec:SwissProtID Q074Z4
NCBI Reference P15692
Aliases /Synonyms VEGF,VPF
Reference PX-P4574
Note For research use only
Molecular Constructor
Met1–Arg191 His