ABHD5 (NM_016006) Human Recombinant Protein

Referencia TP301869

embalaje : 20ug


ABHD5 (NM_016006) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301869
Recombinant protein of human abhydrolase domain containing 5 (ABHD5), 20 µg
 
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201869 protein sequence
Red=Cloning site Green=Tags(s)

MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAEEKMLKCVPCTYKKEPVRISNGNKIWTLKFSH
NISNKTPLVLLHGFGGGLGLWALNFGDLCTNRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRC
ALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILVEPWGFPERPDLADQDRPIPVWIRALGAALTPFNP
LAGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQR
IGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVKEICDTVD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 38.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057090
Locus ID 51099
UniProt ID Q8WTS1
Cytogenetics 3p21.33
RefSeq Size 5370
RefSeq ORF 1047
Synonyms CGI58; IECN2; NCIE2
Summary The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation. provided by RefSeq, Jul 2008
Protein Categories Enzyme: Peptidases, Intracellular Proteins
Protein Families Protease
SKU Description Size
PH301869 ABHD5 MS Standard C13 and N15-labeled recombinant protein (NP_057090) 10 ug
LC402485 Lyophilized ABHD5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY402485 Transient overexpression lysate of abhydrolase domain containing 5 (ABHD5) (as WB positive control) 100 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products

Usted podría estar interesado también en los siguientes productos:



Referencia
Descripción
Cond.
Precio Sin IVA