Anti-DDX4 Polyclonal antibody

Referencia NB-21-36375

embalaje : 100µg

Marca : Neo Biotech


Anti-DDX4 Polyclonal antibody

Product name ARO-A13627-100
Uniprot ID Q9NQI0
Raw Antigen Sequence NRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRG
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Host species Rabbit
Aliases /Synonyms Anti-DDX4,VASA,Vasa homolog,DEAD box protein 4,Probable ATP-dependent RNA helicase DDX4,
Reference ARO-A13627
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human DDX4 (Asn35-Gly131).