Reactivos e instrumentos para inmunología, biología celular y biología molecular.
 
> Anti-Human CCL5/RANTES (NI-0701)

Anti-Human CCL5/RANTES (NI-0701)

Imprimir Imprimir
Por favor conéctese

Referencia NB-21-41895

embalaje : 100µg

Marca : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Clonality:
Monoclonal Antibody
Isotype:
IgG
SDS-PAGE for Anti-Human CCL5/RANTES (NI-0701)

Specifications Anti-Human CCL5/RANTES (NI-0701)

Product name PTX26222-100
Uniprot ID P13501
Raw Antigen Sequence MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-CCL5, Anti-RANTES, Anti-TCP228, NI-0701, NI 0701, NI0701
Isotype IgG
Clonality Monoclonal Antibody
Protein Name CCL5
Product name PTX26222-1MG
Uniprot ID P13501
Raw Antigen Sequence MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-CCL5, Anti-RANTES, Anti-TCP228, NI-0701, NI 0701, NI0701
Isotype IgG
Clonality Monoclonal Antibody
Protein Name CCL5
Product name PTX26222-50
Uniprot ID P13501
Raw Antigen Sequence MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Anti-CCL5, Anti-RANTES, Anti-TCP228, NI-0701, NI 0701, NI0701
Isotype IgG
Clonality Monoclonal Antibody
Protein Name CCL5

Documents

QC & Validation

SDS-PAGE for Anti-Human CCL5/RANTES (NI-0701)

SDS-PAGE for Anti-Human CCL5/RANTES (NI-0701)

Anti-Human CCL5/RANTES (NI-0701), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Reviews

There are no reviews yet.

Be the first to review “Anti-Human CCL5/RANTES (NI-0701)” Cancel reply

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call