Reactivos e instrumentos para inmunología, biología celular y biología molecular.
 
> cDNA FLJ59602, highly similar to Lactotransferrin

cDNA FLJ59602, highly similar to Lactotransferrin

Imprimir Imprimir
Por favor conéctese

Referencia NB-21-24442

embalaje : 100ug

Marca : Neo Biotech


cDNA FLJ59602, highly similar to Lactotransferrin

Product name cDNA FLJ59602, highly similar to Lactotransferrin
Uniprot ID B4E1L2
Uniprot link https://www.uniprot.org/uniprot/B4E1L2
Expression system Eukaryotic expression
Raw Antigen Sequence MHSSALLCCLVLLTGVRAGRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIGGGGSGGGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight 33.87kDa
Purity estimated >90% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Mammalian cells
Fragment Type Gly20-IIe66
Aliases /Synonyms /
Reference PX-P4870
Note For research use only
Molecular Constructor
Gly20–IIe66