Ficolin 3/FCN3 Protein, Human, Recombinant (His)
Referencia NB-64-50015-5ug
embalaje : 5ug
Marca : Neo Biotech
Remove All
Ficolin 3/FCN3 Protein, Human, Recombinant (His)
(Synonyms: Hakata antigen, HAKA1, Ficolin-3, FCNH, FCN3, Collagen/fibrinogen domain-containing protein 3, Collagen/fibrinogen domain-containing lectin 3 p35) Copy Product InfoSynonyms: Hakata antigen, HAKA1, Ficolin-3, FCNH, FCN3, Collagen/fibrinogen domain-containing protein 3, Collagen/fibrinogen domain-containing lectin 3 p35
Catalog No. TMPH-01339 Copy Product Info
May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Has affinity with GalNAc, GlcNAc, D-fucose, as mono/oligosaccharide and lipopolysaccharides from S.typhimurium and S.minnesota. Ficolin 3/FCN3 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 34.4 kDa and the accession number is O75636.
For research use only—not for human use. No sales to individuals. Use as intended only.
Select Batch
Purity:Greater than 85% as determined by SDS-PAGE.
Appearance:Lyophilized powder
Color:White
Contact us for more batch information
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Has affinity with GalNAc, GlcNAc, D-fucose, as mono/oligosaccharide and lipopolysaccharides from S.typhimurium and S.minnesota. Ficolin 3/FCN3 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 34.4 kDa and the accession number is O75636. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | O75636 |
| Amino Acid | QEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR |
| Construction | 24-299 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Hakata antigen, HAKA1, Ficolin-3, FCNH, FCN3, Collagen/fibrinogen domain-containing protein 3, Collagen/fibrinogen domain-containing lectin 3 p35 |
| Research Background | May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Has affinity with GalNAc, GlcNAc, D-fucose, as mono/oligosaccharide and lipopolysaccharides from S.typhimurium and S.minnesota. |
| Molecular Weight | 34.4 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
HAKA 1Ficolin3FCN 3
Related Tags: Ficolin 3/FCN3 Protein, Human, Recombinant (His) chemical structure | Ficolin 3/FCN3 Protein, Human, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

