Inhibin beta B chain(INHBB)

Referencia NB-21-25423

embalaje : 100ug

Marca : Neo Biotech


Inhibin beta B chain(INHBB)

Product name Inhibin beta B chain(INHBB)
Uniprot ID P09529
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Mammalian cells
Fragment Type Gly293-Ala407
Aliases /Synonyms Activin beta-B chain
Reference PX-P4647
Note For research use only
Molecular Constructor
Gly293–Ala407 His