MGMT Protein - PelB-DN10-ST (virer PelB) Recombinant Protein

Referencia NB-21-24949

embalaje : 50ug

Marca : Neo Biotech


MGMT Protein - PelB-DN10-ST (virer PelB) Recombinant Protein

Product name MGMT Protein - PelB-DN10-ST (virer PelB) Recombinant Protein
Uniprot ID P16455
Uniprot link http://www.uniprot.org/uniprot/P16455
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAGSEVQLVESGGGVVQPGDSLRLSCVASGRTDSIYSMAWFRQAPGKEREFVAIITWRREYTNYEDSVRGRFTISRDNAKNAVYLQMNKLKPEDTAVYYCALRPGLRDDLNYWGQGTQVTVSSGGSGGGSGGGSGGSDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWK
Molecular weight 38.40 kDa
Protein delivered with Tag? Yes
Purity estimated 10%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Unknown
Protein Accession AFU51890.1
Spec:Entrez GeneID 4255
Spec:SwissProtID P16455
NCBI Reference AFU51890.1
Aliases /Synonyms PelB-DN10-ST (virer PelB), O-6-methylguanine-DNA methyltransferase
Reference PX-P2087
Note For research use only
Molecular Constructor
Unknown Yes