NAT15 Rabbit Polyclonal Antibody (FITC)

Referencia orb2114244-100ul

embalaje : 100ul

Marca : Biorbyt


NAT15 Rabbit Polyclonal Antibody (FITC)

SKU: orb2114244

Description

NAT15 Rabbit Polyclonal Antibody (FITC) is an FITC conjugated, affinity purified antibody which is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human NAT15. This antibody is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human NAT15
Protein SequenceSynthetic peptide located within the following region: DYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSRT
Molecular Weight27kDa
PurificationAffinity Purified
ConjugationFITC

Storage & Handling

StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HAT4, NatF, NAT15, hNaa60
  • Naa60 Rabbit Polyclonal Antibody (FITC) [orb2114247]

    WB

    Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    FITC

    100 μl
  • NAA60 Rabbit Polyclonal Antibody (FITC) [orb2817118]

    .carousel__track {display: flex;} .carousel__track li {list-style: none;}.product-image {display: flex;align-items: center;}.product-image-wrapper {width: 21%;}.product-image-description {width: 90%;}#reviews {display: none;}

    Human, Mouse, Rat

    Rabbit