Recombinant Mouse FGF2/bFGF Protein, N-His

Specifications Recombinant Mouse FGF2/bFGF Protein, N-His

Product name	ARO-P11135-100
Uniprot ID	P15655
Origin species	Mouse
Expression system	Prokaryotic expression
Raw Antigen Sequence	ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Molecular weight	18.50 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ala11-Ser154
Aliases /Synonyms	Fibroblast growth factor 2, Basic fibroblast growth factor, Heparin-binding growth factor 2, Fgf2, Fgf-2, HBGF-2, FGF-2, bFGF
Reference	ARO-P11135
Note	For research use only.
Molecular Constructor	Ala11–Ser154

Product name	ARO-P11135-1MG
Uniprot ID	P15655
Origin species	Mouse
Expression system	Prokaryotic expression
Raw Antigen Sequence	ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Molecular weight	18.50 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ala11-Ser154
Aliases /Synonyms	Fibroblast growth factor 2, Basic fibroblast growth factor, Heparin-binding growth factor 2, Fgf2, Fgf-2, HBGF-2, FGF-2, bFGF
Reference	ARO-P11135
Note	For research use only.
Molecular Constructor	Ala11–Ser154

Product name	ARO-P11135-50
Uniprot ID	P15655
Origin species	Mouse
Expression system	Prokaryotic expression
Raw Antigen Sequence	ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Molecular weight	18.50 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ala11-Ser154
Aliases /Synonyms	Fibroblast growth factor 2, Basic fibroblast growth factor, Heparin-binding growth factor 2, Fgf2, Fgf-2, HBGF-2, FGF-2, bFGF
Reference	ARO-P11135
Note	For research use only.
Molecular Constructor	Ala11–Ser154

Documents

• Datasheet

3D Representation

Reviews

There are no reviews yet.

Be the first to review “Recombinant Mouse FGF2/bFGF Protein, N-His” Cancel reply