Recombinant Mouse Synapse differentiation-inducing gene protein 1-like(Syndig1l)

Referencia orb2928180-100ug

embalaje : 100ug

Marca : Biorbyt


Recombinant Mouse Synapse differentiation-inducing gene protein 1-like(Syndig1l)

SKU: orb2928180

Description

This Recombinant Mouse Synapse differentiation-inducing gene protein 1-like(Syndig1l) spans the amino acid sequence from region 1-237.

Research Area

Stem Cell & Developmental Biology

Images & Validation

Key Properties

Biological OriginMus musculus (Mouse)
Expression Region1-237
Protein Lengthfull length protein
Protein SequenceMESLSELQNPLLPRSPTHLHRPYPYPEAPPGWSCQEQLYSFLLGGAGPARAHQLLDPGSL QLAVEAWYRPSCLLGRDKVKEPKAGSCETSFTEAREPLAGPAEEGSEPGQAAEDVTIHTV SYGVQEELQGQEDSQEEESDGTSSESECEDAFLTLPPRDHLGLTLFSMLCCFWPLGIAAF YFSQGTSKAISKGDFRLASTTSRRALFLATLSIAVGAGLYVAVVVALAAYMSQNGHG

Storage & Handling

StorageStorage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Form/AppearanceLyophilized powder
Buffer/PreservativesTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Synapse differentiation-inducing gene protein 1-like, Capucin, Caudate and putamen-enriched protein, Synapse differentiation-induced protein 2, Transmembrane protein 90A

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its