TRPA1 Protein, Rat, Recombinant (His & Myc)
Referencia NB-64-52058-5ug
embalaje : 5ug
Marca : Neo Biotech
Remove All
TRPA1 Protein, Rat, Recombinant (His & Myc)
(Synonyms: Wasabi receptor, Trpa1, Transient receptor potential cation channel subfamily A member 1, Ankyrin-like with transmembrane domains protein 1, Anktm1) Copy Product InfoSynonyms: Wasabi receptor, Trpa1, Transient receptor potential cation channel subfamily A member 1, Ankyrin-like with transmembrane domains protein 1, Anktm1
Catalog No. TMPH-03389 Copy Product Info
TRPA1 Protein, Rat, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 27.3 kDa and the accession number is Q6RI86.
For research use only—not for human use. No sales to individuals. Use as intended only.
Select Batch
Purity:85%
Appearance:Lyophilized powder
Color:White
Contact us for more batch information
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | TRPA1 Protein, Rat, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 27.3 kDa and the accession number is Q6RI86. |
| Species | Rat |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | Q6RI86 |
| Amino Acid | IGLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLPFWYLRKVDQRSTIVYPNRPRHGRMLRFFHYFLSMQETRQEAPNIDTCLEMEILKQKYRLKDLTSLLEKQHELIKLIIQKMEIISETEDEDNHCSFQDRFKKERLEQMHSKWNFVLNAVKTKTHCSISHPDI |
| Construction | 960-1125 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Wasabi receptor, Trpa1, Transient receptor potential cation channel subfamily A member 1, Ankyrin-like with transmembrane domains protein 1, Anktm1 |
| Research Background | Receptor-activated non-selective cation channel involved in pain detection and possibly also in cold perception, oxygen concentration perception, cough, itch, and inner ear function. Shows 8-fold preference for divalent over monovalent cations. Has a central role in the pain response to endogenous inflammatory mediators and to a diverse array of irritants, such as allylthiocyanate (AITC) found in mustard oil or wasabi, cinnamaldehyde, diallyl disulfide (DADS) from garlic, and acrolein, an irritant from tears gas and vehicule exhaust fumes. Acts also as an ionotropic cannabinoid receptor by being activated by delta(9)-tetrahydrocannabinol (THC), the psychoactive component of marijuana. Is activated by a large variety of structurally unrelated electrophilic and non-electrophilic chemical compounds. Electrophilic ligands activate TRPA1 by interacting with critical N-terminal Cys residues in a covalent manner, whereas mechanisms of non-electrophilic ligands are not well determined. May be a component for the mechanosensitive transduction channel of hair cells in inner ear, thereby participating in the perception of sounds. Probably operated by a phosphatidylinositol second messenger system. |
| Molecular Weight | 27.3 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
Trpa 1Anktm 1
Related Tags: TRPA1 Protein, Rat, Recombinant (His & Myc) chemical structure | TRPA1 Protein, Rat, Recombinant (His & Myc) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote


