U1 small nuclear ribonucleoprotein C(SNRPC)

Referencia NB-21-25307

embalaje : 100ug

Marca : Neo Biotech


U1 small nuclear ribonucleoprotein C(SNRPC)

Product name U1 small nuclear ribonucleoprotein C(SNRPC)
Uniprot ID F6TFD9
Uniprot link https://www.uniprot.org/uniprot/F6TFD9
Expression system Prokaryotic expression
Raw Antigen Sequence MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
Molecular weight 18.3kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >60% by SDS-PAGE
Buffer 20 mM Tris-HCl,pH8.0, 100mM NaCl, 1mM DTT, 0.1mM EDTA, 10%glycerol,0.1%NaN3
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg159
Protein Accession F6TFD9
NCBI Reference F6TFD9
Aliases /Synonyms U1 snRNP C,SNRPC,U1-C,U1C
Reference PX-P4599
Note For research use only
Molecular Constructor
His Met1–Arg159