PX-TA1132
Vascular endothelial growth factor A(VEGFA)
Referencia NB-21-25351
embalaje : 100ug
embalaje : 100ug
| Product name | Vascular endothelial Growth Factor proteins A(VEGFA) |
|---|---|
| Uniprot ID | P15692-4 |
| Uniprot link | https://www.uniprot.org/uniprot/P15692#P15692-4 |
| Expression system | Eukaryotic expression |
| Raw Antigen Sequence | MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Molecular weight | 20.13kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH 7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1-Arg191 |
| Protein Accession | P15692 |
| Spec:Entrez GeneID | 7422 |
| Spec:NCBI Gene Aliases | VPF; VEGF; MVCD1 |
| Spec:SwissProtID | Q074Z4 |
| NCBI Reference | P15692 |
| Aliases /Synonyms | VEGF,VPF |
| Reference | PX-P4574 |
| Note | For research use only |
| Molecular Constructor | Met1–Arg191 His |
| Product name | Vascular endothelial Growth Factor proteins A(VEGFA) |
|---|---|
| Uniprot ID | P15692-4 |
| Uniprot link | https://www.uniprot.org/uniprot/P15692#P15692-4 |
| Expression system | Eukaryotic expression |
| Raw Antigen Sequence | MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Molecular weight | 20.13kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH 7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1-Arg191 |
| Protein Accession | P15692 |
| Spec:Entrez GeneID | 7422 |
| Spec:NCBI Gene Aliases | VPF; VEGF; MVCD1 |
| Spec:SwissProtID | Q074Z4 |
| NCBI Reference | P15692 |
| Aliases /Synonyms | VEGF,VPF |
| Reference | PX-P4574 |
| Note | For research use only |
| Molecular Constructor | Met1–Arg191 His |
There are no reviews yet.