WDFY1 Antibody - N-terminal region
Referencia ARP57465_P050-25UL
embalaje : 25ul
Marca : Aviva Systems Biology
WDFY1 Antibody - N-terminal region (ARP57465_P050)
| Datasheets/Manuals | Printable datasheet for anti-WDFY1 (ARP57465_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human WDFY1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRV |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-WDFY1 (ARP57465_P050) antibody is Catalog # AAP57465 (Previous Catalog # AAPP41521) |
| Enhanced Validation | Relative Expression (Western Blot)  |
| Gene Symbol | WDFY1 |
|---|---|
| Gene Full Name | WD repeat and FYVE domain containing 1 |
| Alias Symbols | WDF1, FENS1, FENS-1, ZFYVE17 |
| NCBI Gene Id | 57590 |
| Protein Name | WD repeat and FYVE domain-containing protein 1 |
| Description of Target | The FYVE domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate (PtdIns(3)P)-containing membranes. This gene encodes a protein which contains a single FYVE domain and multiple WD40 repeats. This protein is localized to endosomes. |
| Uniprot ID | Q8IWB7 |
| Protein Accession # | NP_065881 |
| Nucleotide Accession # | NM_020830 |
| Protein Size (# AA) | 410 |
| Molecular Weight | 46kDa |
| Protein Interactions | SUMO1; NEDD8; L3HYPDH; UBQLN1; TXNL4A; ELAVL1; |
