Recombinant Human RUNX2, N-His

Cat# NB-21-30788

Size : 100µg

Marca : Neo Biotech


Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13950
Molecular weight:
22.80 kDa
Val219–Val404

Specifications Recombinant Human RUNX2, N-His

Product name ARO-P12825-100
Uniprot ID Q13950
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPV
Molecular weight 22.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val219-Val404
Aliases /Synonyms AML3, OSF2, RUNX2, Core-binding factor subunit alpha-1, PEA2-alpha A, CBF-alpha-1, Osteoblast-specific transcription factor 2, Oncogene AML-3, CBFA1, Runt-related transcription factor 2, PEBP2A, OSF-2, SL3-3 enhancer factor 1 alpha A subunit, PEBP2-alpha A, Acute myeloid leukemia 3 protein, Polyomavirus enhancer-binding protein 2 alpha A subunit, SL3/AKV core-binding factor alpha A subunit
Reference ARO-P12825
Note For research use only.
Molecular Constructor
Val219–Val404
Product name ARO-P12825-1MG
Uniprot ID Q13950
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPV
Molecular weight 22.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val219-Val404
Aliases /Synonyms AML3, OSF2, RUNX2, Core-binding factor subunit alpha-1, PEA2-alpha A, CBF-alpha-1, Osteoblast-specific transcription factor 2, Oncogene AML-3, CBFA1, Runt-related transcription factor 2, PEBP2A, OSF-2, SL3-3 enhancer factor 1 alpha A subunit, PEBP2-alpha A, Acute myeloid leukemia 3 protein, Polyomavirus enhancer-binding protein 2 alpha A subunit, SL3/AKV core-binding factor alpha A subunit
Reference ARO-P12825
Note For research use only.
Molecular Constructor
Val219–Val404
Product name ARO-P12825-50
Uniprot ID Q13950
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPV
Molecular weight 22.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val219-Val404
Aliases /Synonyms AML3, OSF2, RUNX2, Core-binding factor subunit alpha-1, PEA2-alpha A, CBF-alpha-1, Osteoblast-specific transcription factor 2, Oncogene AML-3, CBFA1, Runt-related transcription factor 2, PEBP2A, OSF-2, SL3-3 enhancer factor 1 alpha A subunit, PEBP2-alpha A, Acute myeloid leukemia 3 protein, Polyomavirus enhancer-binding protein 2 alpha A subunit, SL3/AKV core-binding factor alpha A subunit
Reference ARO-P12825
Note For research use only.
Molecular Constructor
Val219–Val404

Documents

3D Representation

Recombinant Human RUNX2, N-His

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human RUNX2, N-His” Cancel reply

Related products

  • Anti-RUNX2 Polyclonal antibody binds to Recombinant Human RUNX2, N-His in WB Assay

    ARO-A13520

    Anti-RUNX2 Polyclonal antibody