Host species: Escherichia coli (E.coli) Origin species: Human Uniprot ID: Q13950 Molecular weight: 22.80 kDa Val219–Val404 Datasheet Specifications Recombinant Human RUNX2, N-His Product name ARO-P12825-100 Uniprot ID Q13950 Origin species Human Expression system Prokaryotic expression Raw Antigen Sequence VTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPV Molecular weight 22.80 kDa Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. Delivery condition Dry Ice Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Val219-Val404 Aliases /Synonyms AML3, OSF2, RUNX2, Core-binding factor subunit alpha-1, PEA2-alpha A, CBF-alpha-1, Osteoblast-specific transcription factor 2, Oncogene AML-3, CBFA1, Runt-related transcription factor 2, PEBP2A, OSF-2, SL3-3 enhancer factor 1 alpha A subunit, PEBP2-alpha A, Acute myeloid leukemia 3 protein, Polyomavirus enhancer-binding protein 2 alpha A subunit, SL3/AKV core-binding factor alpha A subunit Reference ARO-P12825 Note For research use only. Molecular Constructor Val219–Val404 Product name ARO-P12825-1MG Uniprot ID Q13950 Origin species Human Expression system Prokaryotic expression Raw Antigen Sequence VTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPV Molecular weight 22.80 kDa Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. Delivery condition Dry Ice Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Val219-Val404 Aliases /Synonyms AML3, OSF2, RUNX2, Core-binding factor subunit alpha-1, PEA2-alpha A, CBF-alpha-1, Osteoblast-specific transcription factor 2, Oncogene AML-3, CBFA1, Runt-related transcription factor 2, PEBP2A, OSF-2, SL3-3 enhancer factor 1 alpha A subunit, PEBP2-alpha A, Acute myeloid leukemia 3 protein, Polyomavirus enhancer-binding protein 2 alpha A subunit, SL3/AKV core-binding factor alpha A subunit Reference ARO-P12825 Note For research use only. Molecular Constructor Val219–Val404 Product name ARO-P12825-50 Uniprot ID Q13950 Origin species Human Expression system Prokaryotic expression Raw Antigen Sequence VTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPV Molecular weight 22.80 kDa Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. Delivery condition Dry Ice Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Val219-Val404 Aliases /Synonyms AML3, OSF2, RUNX2, Core-binding factor subunit alpha-1, PEA2-alpha A, CBF-alpha-1, Osteoblast-specific transcription factor 2, Oncogene AML-3, CBFA1, Runt-related transcription factor 2, PEBP2A, OSF-2, SL3-3 enhancer factor 1 alpha A subunit, PEBP2-alpha A, Acute myeloid leukemia 3 protein, Polyomavirus enhancer-binding protein 2 alpha A subunit, SL3/AKV core-binding factor alpha A subunit Reference ARO-P12825 Note For research use only. Molecular Constructor Val219–Val404 Documents Datasheet 3D Representation Reviews There are no reviews yet. Be the first to review “Recombinant Human RUNX2, N-His” Cancel reply
There are no reviews yet.